Lineage for d2obpa1 (2obp A:12-92)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907247Family a.4.5.71: ReutB4095-like [158299] (1 protein)
    probable biological unit is a homohexamer
  6. 907248Protein Putative DNA-binding protein ReutB4095 [158300] (1 species)
  7. 907249Species Ralstonia eutropha [TaxId:106590] [158301] (1 PDB entry)
    Uniprot Q46TT3 12-92
  8. 907250Domain d2obpa1: 2obp A:12-92 [148718]
    complexed with cl, no3

Details for d2obpa1

PDB Entry: 2obp (more details), 1.7 Å

PDB Description: crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution
PDB Compounds: (A:) Putative DNA-binding protein

SCOPe Domain Sequences for d2obpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]}
gidpaivevllvlreagiengatpwslpkiakraqlpmsvlrrvltqlqaagladvsvea
dgrghasltqegaalaaqlfp

SCOPe Domain Coordinates for d2obpa1:

Click to download the PDB-style file with coordinates for d2obpa1.
(The format of our PDB-style files is described here.)

Timeline for d2obpa1: