Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.71: ReutB4095-like [158299] (1 protein) probable biological unit is a homohexamer |
Protein Putative DNA-binding protein ReutB4095 [158300] (1 species) |
Species Ralstonia eutropha [TaxId:106590] [158301] (1 PDB entry) Uniprot Q46TT3 12-92 |
Domain d2obpa1: 2obp A:12-92 [148718] complexed with cl, no3 |
PDB Entry: 2obp (more details), 1.7 Å
SCOPe Domain Sequences for d2obpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} gidpaivevllvlreagiengatpwslpkiakraqlpmsvlrrvltqlqaagladvsvea dgrghasltqegaalaaqlfp
Timeline for d2obpa1: