SCOPe 2.05: Domain d2o7cd_: 2o7c D:

Lineage for d2o7cd_ (2o7c D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein automated matches [190399] (9 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [187269] (4 PDB entries)

8. Domain d2o7cd_: 2o7c D: [148666]
   automated match to d1pg8a_
   complexed with so4

Details for d2o7cd_

PDB Entry: 2o7c, 1.7 Å

PDB Description: Crystal structure of L-methionine-lyase from Pseudomonas

PDB Compounds: (D:) methionine gamma-lyase

SCOPe Domain Sequences for d2o7cd_:

Sequence; same for both SEQRES and ATOM records:

>d2o7cd_ c.67.1.3 (D:) automated matches {Pseudomonas putida [TaxId: 303]}
mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
peerahygiseglvrlsvglediddlladvqqalkasa

Timeline for d2o7cd_:

• d2o7cd_ first appeared in SCOP 1.75, called d2o7cd1
  
• d2o7cd_ appears in SCOPe 2.04
  
• d2o7cd_ appears in SCOPe 2.06
  
• d2o7cd_ appears in the current release, SCOPe 2.08