Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) |
Protein Moth pheromone-binding protein, PBP [47569] (2 species) |
Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries) |
Domain d2jpoa1: 2jpo A:1-142 [148166] automatically matched to d1qwva_ |
PDB Entry: 2jpo (more details)
SCOPe Domain Sequences for d2jpoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jpoa1 a.39.2.1 (A:1-142) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]} speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk eihklnwvpnmdlvigevlaev
Timeline for d2jpoa1: