Lineage for d2jj8b_ (2jj8 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865902Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 2865903Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)
  8. 2865923Domain d2jj8b_: 2jj8 B: [148130]
    automated match to d1oe0a_
    complexed with azz, so4

    has additional insertions and/or extensions that are not grouped together

Details for d2jj8b_

PDB Entry: 2jj8 (more details), 2.8 Å

PDB Description: Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase
PDB Compounds: (B:) deoxynucleoside kinase

SCOPe Domain Sequences for d2jj8b_:

Sequence, based on SEQRES records: (download)

>d2jj8b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records): (download)

>d2jj8b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrcvplkylqelhelhedwlihqckv
lvldad

SCOPe Domain Coordinates for d2jj8b_:

Click to download the PDB-style file with coordinates for d2jj8b_.
(The format of our PDB-style files is described here.)

Timeline for d2jj8b_: