Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein S1-domain of exosome complex RNA-binding protein 1, ECR1 [159100] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [159102] (2 PDB entries) Uniprot Q9UXC4 66-152 |
Domain d2jeai1: 2jea I:66-152 [148012] Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeab1, d2jeab2, d2jeai2, d2jeai3 automatically matched to 2JE6 I:66-152 protein/RNA complex; complexed with 1pe |
PDB Entry: 2jea (more details), 2.33 Å
SCOPe Domain Sequences for d2jeai1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jeai1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy viarienfdrsidpvlsvkgkdlgrvs
Timeline for d2jeai1:
View in 3D Domains from other chains: (mouse over for more information) d2jeaa1, d2jeaa2, d2jeab1, d2jeab2 |