Lineage for d2je6i3 (2je6 I:153-221)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553974Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2553975Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2553976Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2553977Protein Exosome complex RNA-binding protein 1, ECR1 [160229] (3 species)
  7. 2553984Species Sulfolobus solfataricus [TaxId:2287] [160232] (4 PDB entries)
    Uniprot Q9UXC4 153-221
  8. 2553985Domain d2je6i3: 2je6 I:153-221 [147997]
    Other proteins in same PDB: d2je6a1, d2je6a2, d2je6a3, d2je6b1, d2je6b2, d2je6i1, d2je6i2
    complexed with 1pe, cl, peg

Details for d2je6i3

PDB Entry: 2je6 (more details), 1.6 Å

PDB Description: structure of a 9-subunit archaeal exosome
PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2je6i3:

Sequence, based on SEQRES records: (download)

>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksgcsifvanngriwatcpsrfseeilieair
kieneshik

Sequence, based on observed residues (ATOM records): (download)

>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksifvanngriwafseeilieairkieneshi
k

SCOPe Domain Coordinates for d2je6i3:

Click to download the PDB-style file with coordinates for d2je6i3.
(The format of our PDB-style files is described here.)

Timeline for d2je6i3: