Lineage for d2jawa_ (2jaw A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883475Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
    automatically mapped to Pfam PF06941
  6. 1883482Protein automated matches [190171] (2 species)
    not a true protein
  7. 1883483Species Human (Homo sapiens) [TaxId:9606] [186899] (17 PDB entries)
  8. 1883499Domain d2jawa_: 2jaw A: [147953]
    automated match to d1q92a_
    complexed with bvp, mg

Details for d2jawa_

PDB Entry: 2jaw (more details), 1.95 Å

PDB Description: crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 5-bromovinyldeoxyuridine 5'-monophosphate
PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d2jawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jawa_ c.108.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrpc

SCOPe Domain Coordinates for d2jawa_:

Click to download the PDB-style file with coordinates for d2jawa_.
(The format of our PDB-style files is described here.)

Timeline for d2jawa_: