Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (4 species) |
Species Aquifex aeolicus [TaxId:63363] [160318] (1 PDB entry) Uniprot O66474 3-108 |
Domain d2j5aa1: 2j5a A:3-108 [147886] complexed with na |
PDB Entry: 2j5a (more details), 2.3 Å
SCOPe Domain Sequences for d2j5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j5aa1 d.58.14.1 (A:3-108) Ribosomal protein S6 {Aquifex aeolicus [TaxId: 63363]} hyktlryyetvfavkptlseeemkkkfeqvkefikqkggeilyeedwgmrqlaypiqkfn naryflvqfktenpqlpneldfqlkidedvirwlniqikesevkkn
Timeline for d2j5aa1: