Lineage for d2ivda2 (2ivd A:307-414)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935459Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2935647Protein Protoporphyrinogen oxidase [102804] (2 species)
  7. 2935648Species Myxococcus xanthus [TaxId:34] [159952] (2 PDB entries)
    Uniprot P56601 307-414
  8. 2935649Domain d2ivda2: 2ivd A:307-414 [147806]
    Other proteins in same PDB: d2ivda1, d2ivdb1
    complexed with acj, fad, gol, twn

Details for d2ivda2

PDB Entry: 2ivd (more details), 2.3 Å

PDB Description: structure of protoporphyrinogen oxidase from myxococcus xanthus with acifluorfen
PDB Compounds: (A:) protoporphyrinogen oxidase

SCOPe Domain Sequences for d2ivda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}
ayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmv
ggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgipq

SCOPe Domain Coordinates for d2ivda2:

Click to download the PDB-style file with coordinates for d2ivda2.
(The format of our PDB-style files is described here.)

Timeline for d2ivda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ivda1