Lineage for d2i6va1 (2i6v A:219-305)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1786391Family b.36.1.5: EpsC C-terminal domain-like [159046] (1 protein)
    PfamB PB005596
  6. 1786392Protein General secretion pathway protein C, EpsC [159047] (1 species)
  7. 1786393Species Vibrio cholerae [TaxId:666] [159048] (2 PDB entries)
    Uniprot P45777 204-305! Uniprot P45777 219-305
  8. 1786394Domain d2i6va1: 2i6v A:219-305 [147530]

Details for d2i6va1

PDB Entry: 2i6v (more details), 1.63 Å

PDB Description: pdz domain of epsc from vibrio cholerae, residues 219-305
PDB Compounds: (A:) General secretion pathway protein C

SCOPe Domain Sequences for d2i6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]}
qeifqyvrlsqvkrddkvlgyrvspgkdpvlfesiglqdgdmavalngldltdpnvmntl
fqsmnemtemsltverdgqqhdvyiqf

SCOPe Domain Coordinates for d2i6va1:

Click to download the PDB-style file with coordinates for d2i6va1.
(The format of our PDB-style files is described here.)

Timeline for d2i6va1: