SCOPe 2.08: Domain d2hoib2: 2hoi B:130-341

Lineage for d2hoib2 (2hoi B:130-341)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)

6. Protein automated matches [254540] (1 species)
   not a true protein
7. Species Enterobacteria phage [TaxId:10678] [255220] (1 PDB entry)

8. Domain d2hoib2: 2hoi B:130-341 [147320]
   Other proteins in same PDB: d2hoia1, d2hoib1, d2hoig1, d2hoih1
   automated match to d1f44a2
   protein/DNA complex

Details for d2hoib2

PDB Entry: 2hoi, 2.6 Å

PDB Description: crystal structure of the tetrameric pre-cleavage synaptic complex in the cre-loxp site-specific recombination

PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d2hoib2:

Sequence; same for both SEQRES and ATOM records:

>d2hoib2 d.163.1.1 (B:130-341) automated matches {Enterobacteria phage [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Timeline for d2hoib2:

• d2hoib2 first appeared in SCOP 1.75
  
• d2hoib2 appears in SCOPe 2.07