Class a: All alpha proteins [46456] (286 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein) Part of Pfam PF01381 |
Protein PrgX [140527] (1 species) possibly involved in pheromone-inducible conjugation |
Species Enterococcus faecalis [TaxId:1351] [140528] (4 PDB entries) Uniprot Q04114 1-69! Uniprot Q04114 2-66 |
Domain d2grma1: 2grm A:1-69 [147161] Other proteins in same PDB: d2grma2, d2grmb1, d2grmb2, d2grmc1, d2grmc2 |
PDB Entry: 2grm (more details), 3 Å
SCOPe Domain Sequences for d2grma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grma1 a.35.1.11 (A:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]} mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe ilnragmnt
Timeline for d2grma1:
View in 3D Domains from other chains: (mouse over for more information) d2grmb1, d2grmb2, d2grmc1, d2grmc2 |