SCOPe 2.05: Domain d2emtb2: 2emt B:199-297

Lineage for d2emtb2 (2emt B:199-297)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.5: Third domain of FERM [50776] (9 proteins)

6. Protein Radixin [50779] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries)

8. Domain d2emtb2: 2emt B:199-297 [146932]
   Other proteins in same PDB: d2emta1, d2emta3, d2emtb1, d2emtb3
   automatically matched to d1gc6a2

Details for d2emtb2

PDB Entry: 2emt, 2.8 Å

PDB Description: crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1

PDB Compounds: (B:) Radixin

SCOPe Domain Sequences for d2emtb2:

Sequence; same for both SEQRES and ATOM records:

>d2emtb2 b.55.1.5 (B:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

Timeline for d2emtb2:

• d2emtb2 first appeared in SCOP 1.75
  
• d2emtb2 appears in SCOPe 2.04
  
• d2emtb2 appears in SCOPe 2.06
  
• d2emtb2 appears in the current release, SCOPe 2.08