Lineage for d2ef7b_ (2ef7 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943405Protein automated matches [190627] (7 species)
    not a true protein
  7. 2943444Species Sulfolobus tokodaii [TaxId:273063] [187663] (1 PDB entry)
  8. 2943445Domain d2ef7b_: 2ef7 B: [146811]
    Other proteins in same PDB: d2ef7a1
    automated match to d2ef7a1

Details for d2ef7b_

PDB Entry: 2ef7 (more details), 2.1 Å

PDB Description: Crystal structure of ST2348, a hypothetical protein with CBS domains from Sulfolobus tokodaii strain7
PDB Compounds: (B:) Hypothetical protein ST2348

SCOPe Domain Sequences for d2ef7b_:

Sequence, based on SEQRES records: (download)

>d2ef7b_ d.37.1.1 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
eivkeymktqvisvtkdaklndiakvmteknigsvivvdgnkpvgiiterdivkaigkgk
sletkaeefmtaslitiredspitgalalmrqfnirhlpvvddkgnlkgiisirditrai
ddmfetmge

Sequence, based on observed residues (ATOM records): (download)

>d2ef7b_ d.37.1.1 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
eivkeymktqvisvtkdaklndiakvmteknigsvivvdgnkpvgiiterdivkaigkgk
sletkaeefmtaslitiredspitgalalmrqfnirhlpvvddkgnlkgiisirditrai
ddmmge

SCOPe Domain Coordinates for d2ef7b_:

Click to download the PDB-style file with coordinates for d2ef7b_.
(The format of our PDB-style files is described here.)

Timeline for d2ef7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ef7a1