Lineage for d2ebhx3 (2ebh X:1094-1285)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927496Family d.3.1.17: PMT C-terminal domain like [159843] (1 protein)
    displays a minimal thiol-protease fold and its catalytic triad; potential redox regulation: the catalytic cysteine can form a disulfide bond with an N-terminal cysteine
  6. 2927497Protein Dermonecrotic toxin, ToxA [159844] (1 species)
    Synonym: Mitogenic toxin PMT
  7. 2927498Species Pasteurella multocida [TaxId:747] [159845] (3 PDB entries)
    Uniprot P17452 1094-1285
  8. 2927500Domain d2ebhx3: 2ebh X:1094-1285 [146771]
    Other proteins in same PDB: d2ebhx1, d2ebhx2

Details for d2ebhx3

PDB Entry: 2ebh (more details), 2.4 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin
PDB Compounds: (X:) Dermonecrotic toxin

SCOPe Domain Sequences for d2ebhx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebhx3 d.3.1.17 (X:1094-1285) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
lenwqvltppqgkilglkqfkltagfpteqsrlpllensvsedlreelmqkidaikndvk
mnslvcmeagssdsvspkvaarlkdmgleagmgasitwwrreggmefshqmhttasfkfa
gkefavdashlqfvhdqldttililpvddwaleiaqrnrainpfveyvsktgnmlalfmp
plftkprltral

SCOPe Domain Coordinates for d2ebhx3:

Click to download the PDB-style file with coordinates for d2ebhx3.
(The format of our PDB-style files is described here.)

Timeline for d2ebhx3: