Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries) Uniprot P46881 9-628 |
Domain d2e2vb2: 2e2v B:9-96 [146668] Other proteins in same PDB: d2e2va1, d2e2vb1 automatically matched to d1av4a2 complexed with cu |
PDB Entry: 2e2v (more details), 1.8 Å
SCOPe Domain Sequences for d2e2vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2vb2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]} aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs garpqevtvsvtngtvisaveldtaatg
Timeline for d2e2vb2: