SCOPe 2.07: Domain d2e2vb1: 2e2v B:212-628

Lineage for d2e2vb1 (2e2v B:212-628)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family)
   automatically mapped to Pfam PF01179

5. Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)

6. Protein Copper amine oxidase, domain 3 [50000] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
   Uniprot P46881 9-628

8. Domain d2e2vb1: 2e2v B:212-628 [146667]
   Other proteins in same PDB: d2e2va2, d2e2va3, d2e2vb2, d2e2vb3
   automatically matched to d1av4a1
   complexed with cu

Details for d2e2vb1

PDB Entry: 2e2v, 1.8 Å

PDB Description: Substrate Schiff-base analogue of copper amine oxidase from Arthrobacter globiformis formed with benzylhydrazine

PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d2e2vb1:

Sequence; same for both SEQRES and ATOM records:

>d2e2vb1 b.30.2.1 (B:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignxdygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

Timeline for d2e2vb1:

• d2e2vb1 first appeared in SCOP 1.75
  
• d2e2vb1 appears in SCOPe 2.06
  
• d2e2vb1 appears in the current release, SCOPe 2.08