Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.6: AlaX-M N-terminal domain-like [159161] (1 protein) Does NOT belong to Pfam PF01411 |
Protein AlaX-M trans-editing enzyme, N-terminal domain [159162] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [159163] (1 PDB entry) Uniprot O57848 1-87 |
Domain d2e1ba1: 2e1b A:1-87 [146623] Other proteins in same PDB: d2e1ba2 complexed with zn |
PDB Entry: 2e1b (more details), 2.7 Å
SCOPe Domain Sequences for d2e1ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1ba1 b.43.3.6 (A:1-87) AlaX-M trans-editing enzyme, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} minmtrklyyedaylkeakgrvleirdnailldqtifyptgggqphdrgtingvevldvy kdeegnvwhvvkepekfkvgdevelki
Timeline for d2e1ba1: