Lineage for d2dstb_ (2dst B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152655Family c.69.1.39: TTHA1544-like [159753] (2 proteins)
    minimal hydrolase fold (one strand less than the cutinase-like family); there is neither catalytic triad, nor nucleopilic residue in the elbow motif
  6. 2152659Protein automated matches [190612] (1 species)
    not a true protein
  7. 2152660Species Thermus thermophilus [TaxId:274] [187634] (1 PDB entry)
  8. 2152661Domain d2dstb_: 2dst B: [146562]
    Other proteins in same PDB: d2dsta1
    automated match to d2dsta1

Details for d2dstb_

PDB Entry: 2dst (more details), 2 Å

PDB Description: Crystal Structure Analysis of TT1977
PDB Compounds: (B:) Hypothetical protein TTHA1544

SCOPe Domain Sequences for d2dstb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dstb_ c.69.1.39 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
rragylhlyglnlvfdrvgkgppvllvaeeasrwpealpegyafylldlpgygrtegprm
apeelahfvagfavmmnlgapwvllrglglalgphlealglralpaegvevaevlsskls
yg

SCOPe Domain Coordinates for d2dstb_:

Click to download the PDB-style file with coordinates for d2dstb_.
(The format of our PDB-style files is described here.)

Timeline for d2dstb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dsta1