Lineage for d2dlxa1 (2dlx A:8-147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878963Family c.47.1.24: UAS domain [159589] (1 protein)
    SMART 00594
  6. 2878964Protein UBX domain-containing protein 7 [159590] (1 species)
  7. 2878965Species Human (Homo sapiens) [TaxId:9606] [159591] (1 PDB entry)
    Uniprot O94888 131-270
  8. 2878966Domain d2dlxa1: 2dlx A:8-147 [146543]
    Other proteins in same PDB: d2dlxa2, d2dlxa3

Details for d2dlxa1

PDB Entry: 2dlx (more details)

PDB Description: solution structure of the uas domain of human ubx domain-containing protein 7
PDB Compounds: (A:) UBX domain-containing protein 7

SCOPe Domain Sequences for d2dlxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlxa1 c.47.1.24 (A:8-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]}
idkklttladlfrppidlmhkgsfetakecgqmqnkwlminiqnvqdfacqclnrdvwsn
eavkniirehfifwqvyhdseegqryiqfyklgdfpyvsildprtgqklvewhqldvssf
ldqvtgflgehgqldglsss

SCOPe Domain Coordinates for d2dlxa1:

Click to download the PDB-style file with coordinates for d2dlxa1.
(The format of our PDB-style files is described here.)

Timeline for d2dlxa1: