Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.24: UAS domain [159589] (1 protein) SMART 00594 |
Protein UBX domain-containing protein 7 [159590] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159591] (1 PDB entry) Uniprot O94888 131-270 |
Domain d2dlxa1: 2dlx A:8-147 [146543] Other proteins in same PDB: d2dlxa2, d2dlxa3 |
PDB Entry: 2dlx (more details)
SCOPe Domain Sequences for d2dlxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlxa1 c.47.1.24 (A:8-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} idkklttladlfrppidlmhkgsfetakecgqmqnkwlminiqnvqdfacqclnrdvwsn eavkniirehfifwqvyhdseegqryiqfyklgdfpyvsildprtgqklvewhqldvssf ldqvtgflgehgqldglsss
Timeline for d2dlxa1: