Lineage for d2daya1 (2day A:8-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939430Family d.20.1.3: RWD domain [110843] (4 proteins)
    Pfam PF05773
  6. 2939431Protein E3 ubiquitin-protein ligase RNF25 [160081] (1 species)
    RING finger protein 25
  7. 2939432Species Human (Homo sapiens) [TaxId:9606] [160082] (2 PDB entries)
    Uniprot Q96BH1 10-125! Uniprot Q96BH1 10-134
  8. 2939433Domain d2daya1: 2day A:8-122 [146479]
    Other proteins in same PDB: d2daya2, d2daya3

Details for d2daya1

PDB Entry: 2day (more details)

PDB Description: solution structure of the rwd domain of human ring finger protein 25
PDB Compounds: (A:) RING finger protein 25

SCOPe Domain Sequences for d2daya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]}
eedwvlpsevevlesiyldelqvikgngrtspweiyitlhpataedqdsqyvcftlvlqv
paeyphevpqisirnprglsdeqihtilqvlghvakaglgtamlyeliekgkeil

SCOPe Domain Coordinates for d2daya1:

Click to download the PDB-style file with coordinates for d2daya1.
(The format of our PDB-style files is described here.)

Timeline for d2daya1: