Lineage for d2c39s1 (2c39 S:1-191)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176588Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2176650Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 2176664Species Sulfolobus solfataricus [TaxId:2287] [159922] (6 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 2176679Domain d2c39s1: 2c39 S:1-191 [146358]
    Other proteins in same PDB: d2c39a2, d2c39b1, d2c39b2, d2c39c2, d2c39d1, d2c39d2, d2c39e2, d2c39f1, d2c39f2, d2c39g2, d2c39i2, d2c39j1, d2c39j2, d2c39k2, d2c39l1, d2c39l2, d2c39m2, d2c39n1, d2c39n2, d2c39o2, d2c39p1, d2c39p2, d2c39q2, d2c39r1, d2c39r2, d2c39s2, d2c39t1, d2c39t2, d2c39u2, d2c39v1, d2c39v2, d2c39w2, d2c39x1, d2c39x2
    automatically matched to 2JE6 A:1-191
    protein/RNA complex; complexed with adp

Details for d2c39s1

PDB Entry: 2c39 (more details), 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp
PDB Compounds: (S:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c39s1:

Sequence, based on SEQRES records: (download)

>d2c39s1 d.14.1.4 (S:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2c39s1 d.14.1.4 (S:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgkl

SCOPe Domain Coordinates for d2c39s1:

Click to download the PDB-style file with coordinates for d2c39s1.
(The format of our PDB-style files is described here.)

Timeline for d2c39s1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c39s2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c39a1, d2c39a2, d2c39b1, d2c39b2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39m1, d2c39m2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39r1, d2c39r2, d2c39t1, d2c39t2, d2c39u1, d2c39u2, d2c39v1, d2c39v2, d2c39w1, d2c39w2, d2c39x1, d2c39x2