Lineage for d2c38h1 (2c38 H:8-155)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194044Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1194045Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1194283Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 1194284Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 1194292Species Sulfolobus solfataricus [TaxId:2287] [159924] (7 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 1194323Domain d2c38h1: 2c38 H:8-155 [146290]
    Other proteins in same PDB: d2c38a1, d2c38a2, d2c38b2, d2c38c1, d2c38c2, d2c38d2, d2c38e1, d2c38e2, d2c38f2, d2c38g1, d2c38g2, d2c38h2, d2c38i1, d2c38i2, d2c38j2, d2c38k1, d2c38k2, d2c38l2, d2c38m1, d2c38m2, d2c38n2, d2c38o1, d2c38o2, d2c38p2, d2c38q1, d2c38q2, d2c38r2, d2c38s1, d2c38s2, d2c38t2, d2c38u1, d2c38u2, d2c38v2, d2c38w1, d2c38w2, d2c38x2
    automatically matched to 2BR2 B:8-155
    protein/RNA complex; complexed with amp, cl

Details for d2c38h1

PDB Entry: 2c38 (more details), 3.1 Å

PDB Description: rnase ph core of the archaeal exosome in complex with a5 rna
PDB Compounds: (H:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2c38h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c38h1 d.14.1.4 (H:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d2c38h1:

Click to download the PDB-style file with coordinates for d2c38h1.
(The format of our PDB-style files is described here.)

Timeline for d2c38h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c38h2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2