Lineage for d2br2m2 (2br2 M:192-275)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663434Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1663435Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1663587Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 1663588Protein automated matches [226956] (5 species)
    not a true protein
  7. Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries)
  8. 1663621Domain d2br2m2: 2br2 M:192-275 [146190]
    Other proteins in same PDB: d2br2a1, d2br2b1, d2br2b2, d2br2c1, d2br2d1, d2br2d2, d2br2e1, d2br2f1, d2br2f2, d2br2g1, d2br2h1, d2br2h2, d2br2i1, d2br2j1, d2br2j2, d2br2k1, d2br2l1, d2br2l2, d2br2m1, d2br2n1, d2br2n2, d2br2o1, d2br2p1, d2br2p2, d2br2q1, d2br2r1, d2br2r2, d2br2s1, d2br2t1, d2br2t2, d2br2u1, d2br2v1, d2br2v2, d2br2w1, d2br2x1, d2br2x2
    automated match to d2je6a2
    complexed with cl

Details for d2br2m2

PDB Entry: 2br2 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome
PDB Compounds: (M:) exosome complex exonuclease 2

SCOPe Domain Sequences for d2br2m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br2m2 d.101.1.0 (M:192-275) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d2br2m2:

Click to download the PDB-style file with coordinates for d2br2m2.
(The format of our PDB-style files is described here.)

Timeline for d2br2m2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2br2m1
View in 3D
Domains from other chains:
(mouse over for more information)
d2br2a1, d2br2a2, d2br2b1, d2br2b2, d2br2c1, d2br2c2, d2br2d1, d2br2d2, d2br2e1, d2br2e2, d2br2f1, d2br2f2, d2br2g1, d2br2g2, d2br2h1, d2br2h2, d2br2i1, d2br2i2, d2br2j1, d2br2j2, d2br2k1, d2br2k2, d2br2l1, d2br2l2, d2br2n1, d2br2n2, d2br2o1, d2br2o2, d2br2p1, d2br2p2, d2br2q1, d2br2q2, d2br2r1, d2br2r2, d2br2s1, d2br2s2, d2br2t1, d2br2t2, d2br2u1, d2br2u2, d2br2v1, d2br2v2, d2br2w1, d2br2w2, d2br2x1, d2br2x2