Lineage for d2br2j1 (2br2 J:8-155)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1636876Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1636877Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 1636885Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 1636894Domain d2br2j1: 2br2 J:8-155 [146183]
    Other proteins in same PDB: d2br2a1, d2br2a2, d2br2b2, d2br2c1, d2br2c2, d2br2d2, d2br2e1, d2br2e2, d2br2f2, d2br2g1, d2br2g2, d2br2h2, d2br2i1, d2br2i2, d2br2j2, d2br2k1, d2br2k2, d2br2l2, d2br2m1, d2br2m2, d2br2n2, d2br2o1, d2br2o2, d2br2p2, d2br2q1, d2br2q2, d2br2r2, d2br2s1, d2br2s2, d2br2t2, d2br2u1, d2br2u2, d2br2v2, d2br2w1, d2br2w2, d2br2x2
    automated match to d2br2b1
    complexed with cl

Details for d2br2j1

PDB Entry: 2br2 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome
PDB Compounds: (J:) exosome complex exonuclease 1

SCOPe Domain Sequences for d2br2j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br2j1 d.14.1.4 (J:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d2br2j1:

Click to download the PDB-style file with coordinates for d2br2j1.
(The format of our PDB-style files is described here.)

Timeline for d2br2j1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2br2j2
View in 3D
Domains from other chains:
(mouse over for more information)
d2br2a1, d2br2a2, d2br2b1, d2br2b2, d2br2c1, d2br2c2, d2br2d1, d2br2d2, d2br2e1, d2br2e2, d2br2f1, d2br2f2, d2br2g1, d2br2g2, d2br2h1, d2br2h2, d2br2i1, d2br2i2, d2br2k1, d2br2k2, d2br2l1, d2br2l2, d2br2m1, d2br2m2, d2br2n1, d2br2n2, d2br2o1, d2br2o2, d2br2p1, d2br2p2, d2br2q1, d2br2q2, d2br2r1, d2br2r2, d2br2s1, d2br2s2, d2br2t1, d2br2t2, d2br2u1, d2br2u2, d2br2v1, d2br2v2, d2br2w1, d2br2w2, d2br2x1, d2br2x2