Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family) duplication: contains two domains of this fold |
Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
Protein Sulfite reductase NirA [160770] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [160771] (2 PDB entries) Uniprot P71753 162-326! Uniprot P71753 407-555 |
Domain d1zj8a4: 1zj8 A:162-326 [146006] Other proteins in same PDB: d1zj8a1, d1zj8a2, d1zj8b1, d1zj8b2 complexed with cl, sf4, srm |
PDB Entry: 1zj8 (more details), 2.8 Å
SCOPe Domain Sequences for d1zj8a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zj8a4 d.134.1.1 (A:162-326) Sulfite reductase NirA {Mycobacterium tuberculosis [TaxId: 1773]} gdcprvvlgsplagesldevldptwaieeivrryigkpdfadlprkyktaisglqdvahe indvafigvnhpehgpgldlwvggglstnpmlaqrvgawvplgevpevwaavtsvfrdyg yrrlrakarlkflikdwgiakfrevleteylkrplidgpapepvk
Timeline for d1zj8a4:
View in 3D Domains from other chains: (mouse over for more information) d1zj8b1, d1zj8b2, d1zj8b3, d1zj8b4 |