Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species) secreted during involution |
Species Sheep (Ovis aries) [TaxId:9940] [109621] (17 PDB entries) Uniprot Q6TMG6 |
Domain d1zbka2: 1zbk A:240-307 [145993] Other proteins in same PDB: d1zbka1 automatically matched to d1ljya2 complexed with nag |
PDB Entry: 1zbk (more details), 2.9 Å
SCOPe Domain Sequences for d1zbka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbka2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat kgnqwvay
Timeline for d1zbka2: