Lineage for d1zbka2 (1zbk A:240-307)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2186175Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2186176Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2186324Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2186357Species Sheep (Ovis aries) [TaxId:9940] [109621] (17 PDB entries)
    Uniprot Q6TMG6
  8. 2186373Domain d1zbka2: 1zbk A:240-307 [145993]
    Other proteins in same PDB: d1zbka1
    automatically matched to d1ljya2
    complexed with nag

Details for d1zbka2

PDB Entry: 1zbk (more details), 2.9 Å

PDB Description: recognition of specific peptide sequences by signalling protein from sheep mammary gland (sps-40): crystal structure of the complex of sps-40 with a peptide trp-pro-trp at 2.9a resolution
PDB Compounds: (A:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1zbka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbka2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d1zbka2:

Click to download the PDB-style file with coordinates for d1zbka2.
(The format of our PDB-style files is described here.)

Timeline for d1zbka2: