SCOPe 2.02: Domain d1zbbb1: 1zbb B:24-102

Lineage for d1zbbb1 (1zbb B:24-102)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)

8. Domain d1zbbb1: 1zbb B:24-102 [145986]
   Other proteins in same PDB: d1zbba1, d1zbbd1, d1zbbe1
   automatically matched to d1p3ob_
   protein/DNA complex

Details for d1zbbb1

PDB Entry: 1zbb, 9 Å

PDB Description: Structure of the 4_601_167 Tetranucleosome

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d1zbbb1:

Sequence; same for both SEQRES and ATOM records:

>d1zbbb1 a.22.1.1 (B:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

Timeline for d1zbbb1:

• d1zbbb1 first appeared in SCOP 1.75
  
• d1zbbb1 appears in SCOPe 2.01
  
• d1zbbb1 appears in SCOPe 2.03
  
• d1zbbb1 appears in the current release, SCOPe 2.08