Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Schistosoma japonicum [TaxId:6182] [225614] (9 PDB entries) |
Domain d1y6eb2: 1y6e B:1-79 [145911] Other proteins in same PDB: d1y6ea1, d1y6eb1 automated match to d1gnea2 |
PDB Entry: 1y6e (more details), 3 Å
SCOPe Domain Sequences for d1y6eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6eb2 c.47.1.0 (B:1-79) automated matches {Schistosoma japonicum [TaxId: 6182]} spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg dvkltqsmaiiryiadkhn
Timeline for d1y6eb2: