Lineage for d1y6eb2 (1y6e B:1-79)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880263Species Schistosoma japonicum [TaxId:6182] [225614] (9 PDB entries)
  8. 2880272Domain d1y6eb2: 1y6e B:1-79 [145911]
    Other proteins in same PDB: d1y6ea1, d1y6eb1
    automated match to d1gnea2

Details for d1y6eb2

PDB Entry: 1y6e (more details), 3 Å

PDB Description: Orthorhombic glutathione S-transferase of Schistosoma japonicum
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1y6eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6eb2 c.47.1.0 (B:1-79) automated matches {Schistosoma japonicum [TaxId: 6182]}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhn

SCOPe Domain Coordinates for d1y6eb2:

Click to download the PDB-style file with coordinates for d1y6eb2.
(The format of our PDB-style files is described here.)

Timeline for d1y6eb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y6eb1