SCOPe 2.06: Domain d1x52a1: 1x52 A:8-118

Lineage for d1x52a1 (1x52 A:8-118)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins)
   automatically mapped to Pfam PF03465

6. Protein Cell division protein pelota [160506] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160507] (1 PDB entry)
   Uniprot Q9BRX2 261-371

8. Domain d1x52a1: 1x52 A:8-118 [145854]
   Other proteins in same PDB: d1x52a2, d1x52a3

Details for d1x52a1

PDB Entry: 1x52

PDB Description: solution structures of the c-terminal domain of the human pelota homolog (cgi-17)

PDB Compounds: (A:) Pelota homolog

SCOPe Domain Sequences for d1x52a1:

Sequence; same for both SEQRES and ATOM records:

>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]}
tvasrlsdtkaagevkalddfykmlqhepdrafyglkqvekaneamaidtllisdelfrh
qdvatrsryvrlvdsvkenagtvrifsslhvsgeqlsqltgvaailrfpvp

Timeline for d1x52a1:

• d1x52a1 first appeared in SCOP 1.75
  
• d1x52a1 appears in SCOPe 2.05
  
• d1x52a1 appears in SCOPe 2.07
  
• d1x52a1 appears in the current release, SCOPe 2.08