Lineage for d2otlg1 (2otl G:12-73)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1975284Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1975285Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1975286Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1975287Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1975288Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1975309Domain d2otlg1: 2otl G:12-73 [145730]
    Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to 1VQ4 G:12-73
    complexed with cd, cl, gir, k, mg, na

Details for d2otlg1

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (G:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d2otlg1:

Sequence, based on SEQRES records: (download)

>d2otlg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d2otlg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d2otlg1:

Click to download the PDB-style file with coordinates for d2otlg1.
(The format of our PDB-style files is described here.)

Timeline for d2otlg1: