Lineage for d2j01z1 (2j01 Z:3-179)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550694Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 1550695Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 1550696Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 1550731Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 1550739Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries)
  8. 1550743Domain d2j01z1: 2j01 Z:3-179 [145582]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1
    Representative structure
    protein/RNA complex

Details for d2j01z1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (Z:) 50S ribosomal protein L25

SCOPe Domain Sequences for d2j01z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01z1 b.53.1.1 (Z:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped

SCOPe Domain Coordinates for d2j01z1:

Click to download the PDB-style file with coordinates for d2j01z1.
(The format of our PDB-style files is described here.)

Timeline for d2j01z1: