Lineage for d2j01w1 (2j01 W:2-110)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649798Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 1649799Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 1649800Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 1649801Protein Ribosomal protein L22 [54845] (5 species)
  7. 1649902Species Thermus thermophilus [TaxId:274] [160267] (10 PDB entries)
  8. 1649904Domain d2j01w1: 2j01 W:2-110 [145579]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01x1, d2j01y1, d2j01z1
    automatically matched to d1bxea_
    protein/RNA complex

Details for d2j01w1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (W:) 50S ribosomal protein L22

SCOPe Domain Sequences for d2j01w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01w1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOPe Domain Coordinates for d2j01w1:

Click to download the PDB-style file with coordinates for d2j01w1.
(The format of our PDB-style files is described here.)

Timeline for d2j01w1: