SCOPe 2.03: Domain d2i26p_: 2i26 P:

Lineage for d2i26p_ (2i26 P:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries)

8. Domain d2i26p_: 2i26 P: [145419]
   Other proteins in same PDB: d2i26l_, d2i26m_, d2i26n1, d2i26q_
   automated match to d2i26o_
   complexed with so4

Details for d2i26p_

PDB Entry: 2i26, 2.5 Å

PDB Description: Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme

PDB Compounds: (P:) New Antigen Receptor Ancestral

SCOPe Domain Sequences for d2i26p_:

Sequence; same for both SEQRES and ATOM records:

>d2i26p_ b.1.1.1 (P:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvnaaa

Timeline for d2i26p_:

• d2i26p_ first appeared in SCOP 1.75, called d2i26p1
  
• d2i26p_ was called d2i26p1 in SCOPe 2.02
  
• d2i26p_ appears in SCOPe 2.04
  
• d2i26p_ appears in the current release, SCOPe 2.08, called d2i26p2