SCOPe 2.01: Domain d2hgq51: 2hgq 5:9-53

Lineage for d2hgq51 (2hgq 5:9-53)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
   Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members

6. Protein Ribosomal protein L33p [144204] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
   Uniprot P35871 8-52

8. Domain d2hgq51: 2hgq 5:9-53 [145333]
   Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1
   automatically matched to 2J01 6:9-53

Details for d2hgq51

PDB Entry: 2hgq, 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.

PDB Compounds: (5:) 50S ribosomal protein L33

SCOPe Domain Sequences for d2hgq51:

Sequence; same for both SEQRES and ATOM records:

>d2hgq51 g.41.8.6 (5:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk

Timeline for d2hgq51:

• d2hgq51 first appeared in SCOP 1.75
  
• d2hgq51 appears in SCOPe 2.02
  
• d2hgq51 appears in the current release, SCOPe 2.08