Lineage for d2cz0a1 (2cz0 A:9-205)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044346Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 1044347Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 1044348Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
  6. 1044358Protein Iron-containing nitrile hydratase [56211] (1 species)
  7. 1044359Species Rhodococcus erythropolis [TaxId:1833] [56212] (3 PDB entries)
    also Rhodococcus sp. R312
  8. 1044360Domain d2cz0a1: 2cz0 A:9-205 [145051]
    Other proteins in same PDB: d2cz0b_
    complexed with bua, fe

Details for d2cz0a1

PDB Entry: 2cz0 (more details), 1.5 Å

PDB Description: photo-activation state of Fe-type NHase in aerobic condition
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2cz0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz0a1 d.149.1.1 (A:9-205) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt

SCOPe Domain Coordinates for d2cz0a1:

Click to download the PDB-style file with coordinates for d2cz0a1.
(The format of our PDB-style files is described here.)

Timeline for d2cz0a1: