Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
Species Thermus thermophilus [TaxId:274] [159158] (11 PDB entries) Uniprot Q72I04 1-205 |
Domain d1vsac1: 1vsa C:3-203 [144518] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 automatically matched to 2J01 E:1-205 protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsac1 b.43.3.2 (C:3-203) Ribosomal protein L3 {Thermus thermophilus [TaxId: 274]} gilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvnrp lkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrwnf aggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeenll lvkgavpgpngglvivretkk
Timeline for d1vsac1: