Lineage for d1vsac1 (1vsa C:3-203)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126852Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 1126853Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 1126953Species Thermus thermophilus [TaxId:274] [159158] (11 PDB entries)
    Uniprot Q72I04 1-205
  8. 1126964Domain d1vsac1: 1vsa C:3-203 [144518]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to 2J01 E:1-205
    protein/RNA complex

Details for d1vsac1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (C:) 50S ribosomal protein L3

SCOPe Domain Sequences for d1vsac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsac1 b.43.3.2 (C:3-203) Ribosomal protein L3 {Thermus thermophilus [TaxId: 274]}
gilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvnrp
lkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrwnf
aggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeenll
lvkgavpgpngglvivretkk

SCOPe Domain Coordinates for d1vsac1:

Click to download the PDB-style file with coordinates for d1vsac1.
(The format of our PDB-style files is described here.)

Timeline for d1vsac1: