Lineage for d1uzhi_ (1uzh I:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031357Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1031358Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1031359Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1031360Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1031379Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 1031418Domain d1uzhi_: 1uzh I: [144400]
    Other proteins in same PDB: d1uzha1, d1uzha2, d1uzhb1, d1uzhb2, d1uzhe1, d1uzhe2, d1uzhh1, d1uzhh2, d1uzhk1, d1uzhk2, d1uzho1, d1uzho2, d1uzhr1, d1uzhr2, d1uzhv1, d1uzhv2
    automated match to d1uzhc1
    complexed with cap, edo, mg

Details for d1uzhi_

PDB Entry: 1uzh (more details), 2.2 Å

PDB Description: a chimeric chlamydomonas, synechococcus rubisco enzyme
PDB Compounds: (I:) ribulose bisphosphate carboxylase small chain 2, ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1uzhi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzhi_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaehsnpeefywtmwkl
pmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrpktardfqpankr
sv

SCOPe Domain Coordinates for d1uzhi_:

Click to download the PDB-style file with coordinates for d1uzhi_.
(The format of our PDB-style files is described here.)

Timeline for d1uzhi_: