Lineage for d1u58a2 (1u58 A:8-144)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021563Protein Immunomodulatory protein m144, alpha-1 and alpha-2 domains [110841] (1 species)
  7. 1021564Species Murine cytomegalovirus [TaxId:10366] [110842] (2 PDB entries)
    Uniprot Q69G19 27-263 # 95% sequence identity
  8. 1021565Domain d1u58a2: 1u58 A:8-144 [144388]
    Other proteins in same PDB: d1u58a1, d1u58b_

Details for d1u58a2

PDB Entry: 1u58 (more details), 1.9 Å

PDB Description: Crystal structure of the murine cytomegalovirus MHC-I homolog m144
PDB Compounds: (A:) MHC-I homolog m144

SCOPe Domain Sequences for d1u58a2:

Sequence, based on SEQRES records: (download)

>d1u58a2 d.19.1.1 (A:8-144) Immunomodulatory protein m144, alpha-1 and alpha-2 domains {Murine cytomegalovirus [TaxId: 10366]}
esglryaytlvvdgtantrrcfgtghvdgeafvgysnnkthgigrwvnashveeenkefv
rqckelqaeldkmqnnskvigvktvqldvgctskiekhyaydgneteddtatsaserdrd
cqkklteyrklvlasav

Sequence, based on observed residues (ATOM records): (download)

>d1u58a2 d.19.1.1 (A:8-144) Immunomodulatory protein m144, alpha-1 and alpha-2 domains {Murine cytomegalovirus [TaxId: 10366]}
esglryaytlvvdgtantrrcfgtghvdgeafvgysnnkthgigrwvnashveeenkefv
rqckelqaeldkmqnnskvigvktvqldvgctskiekhyaydgnetecqkklteyrklvl
asav

SCOPe Domain Coordinates for d1u58a2:

Click to download the PDB-style file with coordinates for d1u58a2.
(The format of our PDB-style files is described here.)

Timeline for d1u58a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u58a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1u58b_