SCOP 1.75: Domain d2uubn1: 2uub N:2-61

Lineage for d2uubn1 (2uub N:2-61)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d2uubn1: 2uub N:2-61 [139945]
   Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
   automatically matched to d1fjgn_
   complexed with 6mz, cm0, k, mg, par, zn

Details for d2uubn1

PDB Entry: 2uub, 2.8 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2uubn1:

Sequence; same for both SEQRES and ATOM records:

>d2uubn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2uubn1:

• d2uubn1 first appeared in SCOP 1.73
  
• d2uubn1 appears in SCOPe 2.01
  
• d2uubn1 appears in the current release, SCOPe 2.08