Lineage for d2uubg1 (2uub G:2-156)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772539Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 772540Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 772541Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 772542Protein Ribosomal protein S7 [47975] (4 species)
  7. 772572Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 772574Domain d2uubg1: 2uub G:2-156 [139939]
    Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
    automatically matched to d1fjgg_
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uubg1

PDB Entry: 2uub (more details), 2.8 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOP Domain Sequences for d2uubg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uubg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d2uubg1:

Click to download the PDB-style file with coordinates for d2uubg1.
(The format of our PDB-style files is described here.)

Timeline for d2uubg1: