Lineage for d2q3sb2 (2q3s B:2-206)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139729Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2140052Protein Hypothetical protein AT5G06450 [102483] (1 species)
    forms a ring-shaped hexamer; function unknown
  7. 2140053Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries)
  8. 2140055Domain d2q3sb2: 2q3s B:2-206 [139803]
    Other proteins in same PDB: d2q3sa3, d2q3sb3, d2q3sc3, d2q3sd3, d2q3se3, d2q3sf3
    automated match to d1vk0a_

Details for d2q3sb2

PDB Entry: 2q3s (more details), 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g06450
PDB Compounds: (B:) Protein At5g06450

SCOPe Domain Sequences for d2q3sb2:

Sequence, based on SEQRES records: (download)

>d2q3sb2 c.55.3.5 (B:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfpe
tetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedld
llrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekag
peeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records): (download)

>d2q3sb2 c.55.3.5 (B:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgftk
tsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllrenh
glvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeqle
aaaiegwlivnvwdqlsde

SCOPe Domain Coordinates for d2q3sb2:

Click to download the PDB-style file with coordinates for d2q3sb2.
(The format of our PDB-style files is described here.)

Timeline for d2q3sb2: