Lineage for d2p7cb1 (2p7c B:1-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694053Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
    automatically mapped to Pfam PF03965
  6. 2694072Protein Penicillinase repressor BlaI [101019] (2 species)
  7. 2694073Species Bacillus licheniformis [TaxId:1402] [101020] (2 PDB entries)
  8. 2694075Domain d2p7cb1: 2p7c B:1-82 [139517]
    automatically matched to d1p6ra_
    protein/DNA complex

Details for d2p7cb1

PDB Entry: 2p7c (more details)

PDB Description: solution structure of the bacillus licheniformis blai monomeric form in complex with the blap half-operator.
PDB Compounds: (B:) Penicillinase repressor

SCOPe Domain Sequences for d2p7cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7cb1 a.4.5.39 (B:1-82) Penicillinase repressor BlaI {Bacillus licheniformis [TaxId: 1402]}
mkkipqisdaelevmkviwkhssintnevikelsktstwspktiqtmllrlikkgalnhh
kegrvfvytpnidesdyievks

SCOPe Domain Coordinates for d2p7cb1:

Click to download the PDB-style file with coordinates for d2p7cb1.
(The format of our PDB-style files is described here.)

Timeline for d2p7cb1: