Lineage for d2p6bd1 (2p6b D:15-160)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1733801Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)
  7. 1733804Species Human (Homo sapiens) [TaxId:9606] [47532] (8 PDB entries)
  8. 1733808Domain d2p6bd1: 2p6b D:15-160 [139514]
    Other proteins in same PDB: d2p6ba_, d2p6bc_
    automatically matched to d1tcob_
    complexed with ca, fe, po4, zn

Details for d2p6bd1

PDB Entry: 2p6b (more details), 2.3 Å

PDB Description: crystal structure of human calcineurin in complex with pvivit peptide
PDB Compounds: (D:) Calcineurin subunit B isoform 1

SCOPe Domain Sequences for d2p6bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6bd1 a.39.1.5 (D:15-160) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
dadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfkef
iegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivdk
tiinadkdgdgrisfeefcavvggld

SCOPe Domain Coordinates for d2p6bd1:

Click to download the PDB-style file with coordinates for d2p6bd1.
(The format of our PDB-style files is described here.)

Timeline for d2p6bd1: