Lineage for d2p4kd1 (2p4k D:1-83)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904342Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 904343Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 904469Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 904522Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)
  8. 904526Domain d2p4kd1: 2p4k D:1-83 [139493]
    Other proteins in same PDB: d2p4ka2, d2p4kb2, d2p4kc2, d2p4kd2
    automatically matched to d1ap5a1
    complexed with mn

Details for d2p4kd1

PDB Entry: 2p4k (more details), 1.48 Å

PDB Description: contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d2p4kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4kd1 a.2.11.1 (D:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaanvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d2p4kd1:

Click to download the PDB-style file with coordinates for d2p4kd1.
(The format of our PDB-style files is described here.)

Timeline for d2p4kd1: