SCOPe 2.05: Domain d2ouba_: 2oub A:

Lineage for d2ouba_ (2oub A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (25 species)
   not a true protein

7. Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)

8. Domain d2ouba_: 2oub A: [139377]
   automated match to d1tgma_
   complexed with 2tn

Details for d2ouba_

PDB Entry: 2oub, 2.75 Å

PDB Description: crystal structure of the complex formed between phospholipase a2 and atenolol at 2.75 a resolution

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2ouba_:

Sequence; same for both SEQRES and ATOM records:

>d2ouba_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d2ouba_:

• d2ouba_ first appeared in SCOP 1.73, called d2ouba1
  
• d2ouba_ appears in SCOPe 2.04
  
• d2ouba_ appears in SCOPe 2.06
  
• d2ouba_ appears in the current release, SCOPe 2.08