SCOPe 2.02: Domain d2oeda1: 2oed A:3-56

Lineage for d2oeda1 (2oed A:3-56)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries)

8. Domain d2oeda1: 2oed A:3-56 [139038]
   automatically matched to d1igd__

Details for d2oeda1

PDB Entry: 2oed

PDB Description: gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings

PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2oeda1:

Sequence; same for both SEQRES and ATOM records:

>d2oeda1 d.15.7.1 (A:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
yklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte

Timeline for d2oeda1:

• d2oeda1 first appeared in SCOP 1.73
  
• d2oeda1 appears in SCOPe 2.01
  
• d2oeda1 appears in SCOPe 2.03
  
• d2oeda1 appears in the current release, SCOPe 2.08, called d2oeda2