Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) dimeric coiled coil |
Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins) |
Protein Rab guanine nucleotide exchange factor Sec2 [144286] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (3 PDB entries) Uniprot P17065 16-162! Uniprot P17065 31-144 |
Domain d2ocyb1: 2ocy B:17-162 [139022] Other proteins in same PDB: d2ocya2, d2ocyb2, d2ocyc1 automatically matched to 2OCY A:16-162 |
PDB Entry: 2ocy (more details), 3.3 Å
SCOPe Domain Sequences for d2ocyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ocyb1 h.1.33.1 (B:17-162) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lstqliesvdkqshleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrl rediakenelrtkaeeeadklnkevedltaslfdeannmvadarkekyaieilnkrlteq lrekdtlldtltlqlknlkkvmhsld
Timeline for d2ocyb1: