SCOPe 2.08: Domain d2ocyb1: 2ocy B:17-162

Lineage for d2ocyb1 (2ocy B:17-162)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family)
   dimeric coiled coil

5. Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)

6. Protein Rab guanine nucleotide exchange factor Sec2 [144286] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (3 PDB entries)
   Uniprot P17065 16-162! Uniprot P17065 31-144

8. Domain d2ocyb1: 2ocy B:17-162 [139022]
   Other proteins in same PDB: d2ocya2, d2ocyb2, d2ocyc1
   automatically matched to 2OCY A:16-162

Details for d2ocyb1

PDB Entry: 2ocy, 3.3 Å

PDB Description: complex of the guanine exchange factor sec2p and the rab gtpase sec4p

PDB Compounds: (B:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d2ocyb1:

Sequence; same for both SEQRES and ATOM records:

>d2ocyb1 h.1.33.1 (B:17-162) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lstqliesvdkqshleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrl
rediakenelrtkaeeeadklnkevedltaslfdeannmvadarkekyaieilnkrlteq
lrekdtlldtltlqlknlkkvmhsld

Timeline for d2ocyb1:

• d2ocyb1 first appeared in SCOP 1.73
  
• d2ocyb1 appears in SCOPe 2.07