Lineage for d2o1pa3 (2o1p A:352-526)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196795Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2196796Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
    automatically mapped to Pfam PF04926
  6. 2196797Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 2196798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries)
  8. 2196803Domain d2o1pa3: 2o1p A:352-526 [138877]
    Other proteins in same PDB: d2o1pa1, d2o1pa2, d2o1pa4, d2o1pb1, d2o1pb2, d2o1pb4
    automated match to d1fa0a1

Details for d2o1pa3

PDB Entry: 2o1p (more details), 2.7 Å

PDB Description: Structure of yeast Poly(A) Polymerase in a somewhat closed state
PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d2o1pa3:

Sequence, based on SEQRES records: (download)

>d2o1pa3 d.58.16.1 (A:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene

Sequence, based on observed residues (ATOM records): (download)

>d2o1pa3 d.58.16.1 (A:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdeikdapkaylstmyigldfnienkke
kvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene

SCOPe Domain Coordinates for d2o1pa3:

Click to download the PDB-style file with coordinates for d2o1pa3.
(The format of our PDB-style files is described here.)

Timeline for d2o1pa3: