Lineage for d2nybd1 (2nyb D:1-82)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303512Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2303540Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 2303545Species Escherichia coli [TaxId:562] [46614] (5 PDB entries)
  8. 2303549Domain d2nybd1: 2nyb D:1-82 [138810]
    Other proteins in same PDB: d2nyba2, d2nybb2, d2nybc2, d2nybd2
    automated match to d1isca1
    complexed with fe2, o

Details for d2nybd1

PDB Entry: 2nyb (more details), 1.1 Å

PDB Description: crystal structure of e.coli iron superoxide dismutase q69e at 1.1 angstrom resolution
PDB Compounds: (D:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2nybd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nybd1 a.2.11.1 (D:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaevwnhtfywnclap

SCOPe Domain Coordinates for d2nybd1:

Click to download the PDB-style file with coordinates for d2nybd1.
(The format of our PDB-style files is described here.)

Timeline for d2nybd1: